PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024863.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 371aa    MW: 41371.3 Da    PI: 8.8524
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024863.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1739.2e-54311581128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ ++
  Pbr024863.1  31 LPPGFRFHPTDEELVVHYLKKKATSAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSgGT 127
                  79****************************.88***************988899***************************************99777 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Pbr024863.1 128 QKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 158
                  88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-6527192IPR003441NAC domain
PROSITE profilePS5100561.96131192IPR003441NAC domain
PfamPF023653.4E-2832158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MESTDSSAGS QQKQQQQQQP QPQPPPPQPN LPPGFRFHPT DEELVVHYLK KKATSAPLPV  60
AIIAEVDLYK FDPWELPAKA TFGEQEWYFF SPRDRKYPNG ARPNRAATSG YWKATGTDKP  120
VLTSGGTQKV GVKKALVFYG GKPPKGIKTN WIMHEYRLAD NKPNNKPPGC DLGNKKNSLR  180
LDDWVLCRIY KKNNTHRPMD HEREDSMEDI MGPLMPPSIS HVGHHQNMKL HFPKSNSSYG  240
PPFMENDQIF FDGIMSSTDG SASTHQLQLK RPIVPSLYWN NQEDDQTAAD PSSSKRIQLH  300
QLDNGTNSYG DGINGGSTNN NSTSIANLLS QLPRTPPLHQ HAVLGSLGDG IYRTPYQLPG  360
MNWYSESNLG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-74211957168NAC domain-containing protein 19
4dul_A1e-74211957168NAC domain-containing protein 19
1ut7_B1e-74211957168NO APICAL MERISTEM PROTEIN
1ut7_A1e-74211957168NO APICAL MERISTEM PROTEIN
1ut4_B1e-74211957168NO APICAL MERISTEM PROTEIN
1ut4_A1e-74211957168NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981160.0KF198116.1 Malus hupehensis NAC domain protein (NAC32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334622.10.0PREDICTED: NAC domain-containing protein 18
SwissprotQ9LD441e-123NAC56_ARATH; NAC transcription factor 56
TrEMBLD9ZJA40.0D9ZJA4_MALDO; NAC domain class transcription factor
STRINGGLYMA12G34990.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-123NAC domain containing protein 2